Synonym：Epidermal Growth Factor, Urogastrone,URG
Source：E. coli
Structure:Assession Number: P01133 Gene ID: 1950
NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELR
Around 6.2 kDa
Purity:≥95% as determined by SDS-PAGE & HPLC.
SDS-PAG
Endotoxin：< 0.1 EU/μg
Formulation：PBS pH 7.4，0.2μm Membrane filtration for sterilization
Biological Activity
Recombinant human EGF stimulates cell proliferation through mouse Balb/c 3T3 cells, with ED50 ≤ 0.1 ng/mL and corresponding specific activity ≥ 1.0 × 10
7 units/mg
Reconstitution：
1. Before opening, please briefly centrifuge the contents to the bottom;
2. It is recommended to initially dissolve in sterile deionized water to an appropriate concentration (recommended concent ration is 0.1-1mg/ml);
3. If the above storage liquid needs to be stored, it should bemdivided into small quantities and equal parts (not less than 20μl) If further dilution is required, it should be stored in a suitable buffer containing carrier protein.
Shipping & Storage:
The product is shipped with blue ice.Iflong-term siorage is required, this produet should be storedat < -20 °C, please avoid repeated fireeze-thaw1. Dry powdercan be stored at < -20 9C for at least 24 months,2. After reconstitution, it can be stored for l month understerile conditions at 2-8 C :3. Afer reconstitution, it can be stored for 12 months understerile conditions at -20- -70C.
