Synonym：Interleukin-12, NKSF, CTL MaturationFactor (TCMF), Cytotoxic Lymphocyte MaturationFactor (CL
MF), TSF
Source：CHO cells proteinStr
Structure:The protein carries no tag
Assession Number:p35: P29459 p40 : P29460I
Gene ID:p35: 3592 p40: 3593
AA sequence:
p35 Subunit:RNLPVATPDPGMFPCLHHSQNLLRAVSNMLQKARQTLEFYPCTSEEIDHEDITKDKTSTVEACLPLELTKNESCLNSRETSFITNGSCLASRKTSFMMALCLSSIYEDLKMYQVEFKTMNAKLLMDPKRQIFLDQNMLAVIDELMQALNFNSETVPQKSSLEEPDFYKTKIKLCILLHAFRIRAVTIDRVMSYLNAS
p40 Subunit:Subunit;IWELKKDYYVVELDWYPDAPGEMVYLTCDTPEEDGITWTLDOSSEVLGSGKTLTTOVKEFGDAGOYTCHKGGEVLSHSILLLHKKEDGIWSTDILKDOKEPKNKTFLRCEAKNYSGRFICWWLTTISTDLTFSVKSSRGSSDPOGVICGAATLSAERVRGDNKEYEYSVECOEDSACPAAEESLPIEVMVDAVHKIKYENYTSSFFIRDIIKPDPPKNLOLKPLKNSROVEVSWEYPDTWSTPHSYFSLIFCVOVOGKSKREKKDRVFIDKTSATVICRKNASISVRAODRYYSSSWSEWASVPC
Molecular Weight :
Approximately 75kDa, consisting of a 306 amino acid residue p40 subunit and a 197 amino acid residue p35 subunit.
Purity: ≥95 % as determined by SDS-PAGE & HPLC
SDS-PAGE
Recombinant human IL-12 was separated by SDS-PAGE under reduced (R) conditions and showed R-bands at 40 and 35 kDa, corresponding to the molecular weights of the subunits of P40 and P35, respectively.
Endotoxin：< 0.1 EU/μg
Formulation：
PBS pH7.4，0.2μm Membrane filtration for sterilization
Biological Activity:
The ED50 as determined by a cell proliferation assay using PHA-activated human T lymphoblasts is ＜0.05 ng/mL, corresponding to a specific activity of > 2.0 × 107 Units/mg
Reconstitution：
1. Before opening, please briefly centrifuge the contents to the bottom;
2. It is recommended to initially dissolve in sterile deionized water to an appropriate concentration (recommended concentration is 0.1-1mg/ml);
3. If the above storage liquid needs to be stored, it should be divided into small quantities and equal parts (not less than 20 μl) If further dilution is required, it should be stored in a suitable buffer containing carrier protein
Shipping & Storage:
The product is shipped with blue ice.
If long-term storage is required, this product should be stored
at ≤ -20 ℃, please avoid repeated freeze-thaw cycles.
1. Dry powder can be stored at ≤ -20 ℃ for at least 24 months;
2. After reconstitution, it can be stored for 1 month under sterile conditions at 2-8 ℃ ;
3. After reconstitution, it can be stored for 12 months under sterile conditions at -20~ -70℃.
Order Imformations：
Cat.NO. | Name | Grade | Size |
CY071F0010 | IL-12 | RUO | 10μg |
CY071F0020 | IL-12 | RUO | 20μg |
CY071F0050 | IL-12 | RUO | 50μg |
CYG071F0050 | IL-12 | GMP | 50μg |
CYG071F0500 | IL-12 | GMP | 500μg |
