CHASELECTION IL-12

IL-12 is a heterodimeric cytokine containing p35 and p40 sub units, secreted by monocytes,macrophages, dendritic cells, neutrophils, Langerhans cells,keratinocytes, microglia, and perip heral B cells.In humans, the p40 subunit can also bind to the p19 subunit to form IL-23. IL-12 transmits signals through receptor complexes composed of IL-12R β1 and IL-12R β2 . It promotes Th1 immune response by inducing the secretion of IF N -γby NK cells, T cells, and macrophages, as well as enhancing NK and T cell-mediated cytotoxicity. In general, it also collaborates with IL-18 to produceTh1memory cells.

Synonym：

Interleukin-12, NKSF, CTL MaturationFactor (TCMF), Cytotoxic Lymphocyte MaturationFactor (CL

MF), TSF

Source：CHO cells proteinStr

Structure:The protein carries no tag

Assession Number:p35: P29459 p40 : P29460I

Gene ID:p35: 3592 p40: 3593

AA sequence:

p35 Subunit:

RNLPVATPDPGMFPCLHHSQNLLRAVSNMLQKARQTLEFYPCTSEEIDHEDITKDKTSTVEACLPLELTKNESCLNSRETSFITNGSCLASRKTSFMMALCLSSIYEDLKMYQVEFKTMNAKLLMDPKRQIFLDQNMLAVIDELMQALNFNSETVPQKSSLEEPDFYKTKIKLCILLHAFRIRAVTIDRVMSYLNAS

p40 Subunit: Subunit;IWELKKDYYVVELDWYPDAPGEMVYLTCDTPEEDGITWTLDOSSEVLGSGKTLTTOVKEFGDAGOYTCHKGGEVLSHSILLLHKKEDGIWSTDILKDOKEPKNKTFLRCEAKNYSGRFICWWLTTISTDLTFSVKSSRGSSDPOGVICGAATLSAERVRGDNKEYEYSVECOEDSACPAAEESLPIEVMVDAVHKIKYENYTSSFFIRDIIKPDPPKNLOLKPLKNSROVEVSWEYPDTWSTPHSYFSLIFCVOVOGKSKREKKDRVFIDKTSATVICRKNASISVRAODRYYSSSWSEWASVPC

Molecular Weight :

Approximately 75kDa, consisting of a 306 amino acid residue p40 subunit and a 197 amino acid residue p35 subunit.

Purity: ≥95 % as determined by SDS-PAGE & HPLC

SDS-PAGE

Recombinant human IL-12 was separated by SDS-PAGE under reduced (R) conditions and showed R-bands at 40 and 35 kDa, corresponding to the molecular weights of the subunits of P40 and P35, respectively.

Endotoxin：< 0.1 EU/μg

Formulation：

PBS pH7.4，0.2μm Membrane filtration for sterilization

Biological Activity:

The ED50 as determined by a cell proliferation assay using PHA-activated human T lymphoblasts is ＜0.05 ng/mL, corresponding to a specific activity of > 2.0 × 107 Units/mg

Reconstitution：

1. Before opening, please briefly centrifuge the contents to the bottom;

2. It is recommended to initially dissolve in sterile deionized water to an appropriate concentration (recommended concentration is 0.1-1mg/ml);

3. If the above storage liquid needs to be stored, it should be divided into small quantities and equal parts (not less than 20 μl) If further dilution is required, it should be stored in a suitable buffer containing carrier protein

Shipping & Storage:

The product is shipped with blue ice.

If long-term storage is required, this product should be stored

at ≤ -20 ℃, please avoid repeated freeze-thaw cycles.

1. Dry powder can be stored at ≤ -20 ℃ for at least 24 months;

2. After reconstitution, it can be stored for 1 month under sterile conditions at 2-8 ℃ ;

3. After reconstitution, it can be stored for 12 months under sterile conditions at -20~ -70℃.

Order Imformations：

Cat.NO.	Name	Grade	Size
CY071F0010	IL-12	RUO	10μg
CY071F0020	IL-12	RUO	20μg
CY071F0050	IL-12	RUO	50μg
CYG071F0050	IL-12	GMP	50μg
CYG071F0500	IL-12	GMP	500μg

Cytokine Series Brochure.pdf

【EN】IL-12 instrument H2309.pdf